SARS-CoV-2 Spike Monoclonal Antibody |
A73664 |
EpiGentek |
|
|
Iga Monoclonal Laboratories manufactures the iga monoclonal spike reagents distributed by Genprice. The Iga Monoclonal Spike reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Spike
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Spike information
HRP*Monoclonal Mouse Anti- Human IgA |
C030249-10ml |
Unibiotest |
10ml |
EUR 2148 |
HRP*Monoclonal Mouse Anti- Human IgA |
C030249-1ml |
Unibiotest |
1ml |
EUR 424.8 |
FITC*Monoclonal Mouse Anti- Human IgA |
C030649-10ml |
Unibiotest |
10ml |
EUR 2148 |
FITC*Monoclonal Mouse Anti- Human IgA |
C030649-1ml |
Unibiotest |
1ml |
EUR 373.2 |
BIOTIN*Monoclonal Mouse Anti- Human IgA |
C030849-10ml |
Unibiotest |
10ml |
EUR 2148 |
BIOTIN*Monoclonal Mouse Anti- Human IgA |
C030849-1ml |
Unibiotest |
1ml |
EUR 424.8 |
Mouse Anti Monkey Iga Monoclonal Antibody,Biotin |
DMABT-48822MM |
Creative Diagnostics |
0.25 mg |
EUR 1070.4 |
Anti-Mouse IgA, Rabbit Monoclonal Antibody |
A1787-50 |
Biovision |
each |
EUR 444 |
Mouse Anti-HDM IgA Monoclonal Antibody, Clone G4H9G12 |
7132 |
Chondrex |
1 mg/ml x 0.1 ml |
EUR 406.26 |
Description: Mouse Anti-HDM IgA Monoclonal Antibody |
Mouse Anti-Ovalbumin IgA Monoclonal Antibody, Clone 2G12E12 |
7090 |
Chondrex |
1 mg/ml x 0.1 ml |
EUR 406.26 |
Description: Mouse Anti-Ovalbumin IgA Monoclonal Antibody |
Anti-Human IgA (?1 & ?2) Rabbit Monoclonal Antibody |
A1796-50 |
Biovision |
each |
EUR 352.8 |
Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/764 |
AMM01637G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC |
Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/515 |
AMM01640G |
Leading Biology |
7 ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC |