Iga Monoclonal Spike

SARS-CoV-2 Spike Monoclonal Antibody

A73664
  • EUR 341.00
  • EUR 518.10
  • 50 ul
  • 100 ul

Iga Monoclonal Laboratories manufactures the iga monoclonal spike reagents distributed by Genprice. The Iga Monoclonal Spike reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact iga monoclonal. Other Iga products are available in stock. Specificity: Iga Category: Monoclonal Group: Spike

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Spike information

HRP*Monoclonal Mouse Anti- Human IgA

C030249-10ml 10ml
EUR 2148

HRP*Monoclonal Mouse Anti- Human IgA

C030249-1ml 1ml
EUR 424.8

FITC*Monoclonal Mouse Anti- Human IgA

C030649-10ml 10ml
EUR 2148

FITC*Monoclonal Mouse Anti- Human IgA

C030649-1ml 1ml
EUR 373.2

BIOTIN*Monoclonal Mouse Anti- Human IgA

C030849-10ml 10ml
EUR 2148

BIOTIN*Monoclonal Mouse Anti- Human IgA

C030849-1ml 1ml
EUR 424.8

Mouse Anti Human Iga Monoclonal Antibody,FITC

CABT-48819MH 0.1 mg
EUR 889.2

Mouse Anti Bovine Iga Monoclonal Antibody,HRP

DMABT-51898MB 0.25 mg
EUR 889.2

Mouse Anti Cat Iga Monoclonal Antibody,Biotin

DMABT-51972MC 0.25 mg
EUR 1070.4

Mouse Anti Monkey Iga Monoclonal Antibody,Biotin

DMABT-48822MM 0.25 mg
EUR 1070.4

Mouse Anti Bovine/Ovine Iga Monoclonal Antibody

DMABT-51900MB 2 ml
EUR 889.2

Anti-Mouse IgA, Rabbit Monoclonal Antibody

A1787-50 each
EUR 444

Mouse Anti-HDM IgA Monoclonal Antibody, Clone G4H9G12

7132 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-HDM IgA Monoclonal Antibody

Mouse Anti-Ovalbumin IgA Monoclonal Antibody, Clone 2G12E12

7090 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgA Monoclonal Antibody

Anti-Human IgA (?1 & ?2) Rabbit Monoclonal Antibody

A1796-50 each
EUR 352.8

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/764

AMM01637G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/764. This antibody is applicable in IHC, IF, FC

Monoclonal CD79a (B-Cell Marker) Antibody, Clone: IGA/515

AMM01640G 7 ml
EUR 580.8
Description: A Monoclonal antibody against Human CD79a (B-Cell Marker). The antibodies are raised in Mouse and are from clone IGA/515. This antibody is applicable in IHC, IF, FC